PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P20860_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 554aa    MW: 61071 Da    PI: 7.1151
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P20860_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS194.18.8e-602384862280
                   GRAS   2 velLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            v+lL+e A++v++ ++  a+ +Larl+++  sp g+p+ R a+yf+eAL+  l++                       +a+k+fsevs
  GSMUA_Achr5P20860_001 238 VDLLFETAKMVEACNFVGAHGILARLNHQlPSPLGKPLIRSAFYFKEALQLILSN-----------------------SAYKVFSEVS 302
                            789************************998********************99998.......................589******* PP

                   GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp....egppslRiTgvgspesgskeeleetgerLakfAeel 172
                            Pi++fs++t+ qa+le++ g++r+HiiDfdi+ G+QW +++q+La R+    ++   l+iT++++ +s+++  l  ++++L++fA+++
  GSMUA_Achr5P20860_001 303 PIIQFSNFTCTQALLEELGGSDRIHIIDFDIGFGGQWSSFMQELALRRcsaaGPVRLLKITAFVPYRSQNNLDLCLVRDNLSHFASNV 390
                            **********************************************99988555669********9999******************* PP

                   GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflea 260
                            ++p+ef+v   ++l+++++ +L    gEa+aVnl +   +l           +++L++v++lsP++vv v+q +++++ +Fl++f++a
  GSMUA_Achr5P20860_001 391 NIPLEFSV---HSLDSFDPLKLLGAGGEAIAVNLPVGSVNLS---------FTALLRVVRQLSPRIVVSVDQGCNRSDLPFLQHFIHA 466
                            *******9...689999999**9999**********888885.........467********************************** PP

                   GRAS 261 leyysalfdsleaklprese 280
                            ++  +al++s++a++   ++
  GSMUA_Achr5P20860_001 467 FQSSMALMESIDASVLGRHR 486
                            ***********887655444 PP

2GRAS59.47.4e-19488553309374
                   GRAS 309 hetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              ++  Wr+  ++ GF p+++s+++++qa++ll++v+++g++ve+ ++sl+l+W++++LvsvSaWr
  GSMUA_Achr5P20860_001 488 ADKMLPWRMHYTTTGFVPMQFSDFTETQAECLLKRVQVRGFHVEKCQASLCLYWQHKELVSVSAWR 553
                            456779***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098526.474211554IPR005202Transcription factor GRAS
PfamPF035143.0E-57238486IPR005202Transcription factor GRAS
PfamPF035142.6E-16488553IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MRGLPFHDQG KRGLEAVNTI LEGNQALFWV NKRPKLIIPE VVEPRSVLDH RSPSSPTSTA  60
TLSSSLGSGS SCDTAVVAAV SGNSANKCSL SDSRRGERCG LGVEDWEVML SETSAASHGR  120
EQTFLRWIMG DVEDPSAAGL KQQQLQLLLS QGPVDFPGNN GNLGFGILDP GMCFPNAMED  180
KPQFFGPELL VNQPLANSSP PFLLNVGQLE HQQLSHLLAT QPKRHRPVVD HQLQKSVVDL  240
LFETAKMVEA CNFVGAHGIL ARLNHQLPSP LGKPLIRSAF YFKEALQLIL SNSAYKVFSE  300
VSPIIQFSNF TCTQALLEEL GGSDRIHIID FDIGFGGQWS SFMQELALRR CSAAGPVRLL  360
KITAFVPYRS QNNLDLCLVR DNLSHFASNV NIPLEFSVHS LDSFDPLKLL GAGGEAIAVN  420
LPVGSVNLSF TALLRVVRQL SPRIVVSVDQ GCNRSDLPFL QHFIHAFQSS MALMESIDAS  480
VLGRHRAADK MLPWRMHYTT TGFVPMQFSD FTETQAECLL KRVQVRGFHV EKCQASLCLY  540
WQHKELVSVS AWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-2127255337375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009401671.10.0PREDICTED: scarecrow-like protein 27
TrEMBLM0T0B50.0M0T0B5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P20860_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20203796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.12e-88GRAS family protein